Lineage for d1drva2 (1drv A:131-240)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2527131Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 2527132Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 2527526Family d.81.1.3: Dihydrodipicolinate reductase-like [55368] (6 proteins)
  6. 2527568Protein Dihydrodipicolinate reductase [55371] (3 species)
  7. 2527569Species Escherichia coli [TaxId:562] [55372] (5 PDB entries)
  8. 2527573Domain d1drva2: 1drv A:131-240 [39973]
    Other proteins in same PDB: d1drva1
    complexed with a3d

Details for d1drva2

PDB Entry: 1drv (more details), 2.2 Å

PDB Description: escherichia coli dhpr/acnadh complex
PDB Compounds: (A:) dihydrodipicolinate reductase

SCOPe Domain Sequences for d1drva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1drva2 d.81.1.3 (A:131-240) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]}
vgvnvmlkllekaakvmgdytdieiieahhrhkvdapsgtalamgeaiahaldkdlkdca
vysreghtgervpgtigfatvragdivgehtamfadigerleithkassr

SCOPe Domain Coordinates for d1drva2:

Click to download the PDB-style file with coordinates for d1drva2.
(The format of our PDB-style files is described here.)

Timeline for d1drva2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1drva1