Lineage for d6llfc2 (6llf C:143-384)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2581738Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2582036Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 2582202Family d.129.3.3: Ring hydroxylating alpha subunit catalytic domain [55969] (7 proteins)
    Pfam PF00848; contains a few insertion and C-terminal extension compared with Bet v1
  6. 2582292Protein automated matches [319939] (2 species)
    not a true protein
  7. 2582297Species Janthinobacterium sp. [TaxId:213804] [399623] (9 PDB entries)
  8. 2582304Domain d6llfc2: 6llf C:143-384 [399725]
    Other proteins in same PDB: d6llfa1, d6llfa3, d6llfb1, d6llfb3, d6llfc1, d6llfc3
    automated match to d2de6a2
    complexed with edo, fe2, fes, gol, peg, pge, wbp

Details for d6llfc2

PDB Entry: 6llf (more details), 1.93 Å

PDB Description: biphenyl-2,2',3-triol-soaked resting complex of oxy and fd in carbazole 1,9a-dioxygenase
PDB Compounds: (C:) terminal oxygenase component of carbazole

SCOPe Domain Sequences for d6llfc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6llfc2 d.129.3.3 (C:143-384) automated matches {Janthinobacterium sp. [TaxId: 213804]}
pplardtppnfldddmeilgknqiiksnwrlavengfdpshiyihkdsilvkdndlalpl
gfapggdrkqqtrvvdddvvgrkgvydligehgvpvfegtiggevvregaygekivandi
siwlpgvlkvnpfpnpdmmqfewyvpidenthyyfqtlgkpcandeerkkyeqefeskwk
pmalegfnnddiwareamvdfyaddkgwvneilfesdeaivawrklasehnqgiqtqahv
sg

SCOPe Domain Coordinates for d6llfc2:

Click to download the PDB-style file with coordinates for d6llfc2.
(The format of our PDB-style files is described here.)

Timeline for d6llfc2: