Lineage for d1drw_2 (1drw 131-240)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 81620Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
  4. 81621Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
  5. 81742Family d.81.1.3: Dihydrodipicolinate reductase-like [55368] (2 proteins)
  6. 81752Protein Dihydrodipicolinate reductase [55371] (1 species)
  7. 81753Species Escherichia coli [TaxId:562] [55372] (5 PDB entries)
  8. 81756Domain d1drw_2: 1drw 131-240 [39972]
    Other proteins in same PDB: d1drw_1

Details for d1drw_2

PDB Entry: 1drw (more details), 2.2 Å

PDB Description: escherichia coli dhpr/nhdh complex

SCOP Domain Sequences for d1drw_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1drw_2 d.81.1.3 (131-240) Dihydrodipicolinate reductase {Escherichia coli}
vgvnvmlkllekaakvmgdytdieiieahhrhkvdapsgtalamgeaiahaldkdlkdca
vysreghtgervpgtigfatvragdivgehtamfadigerleithkassr

SCOP Domain Coordinates for d1drw_2:

Click to download the PDB-style file with coordinates for d1drw_2.
(The format of our PDB-style files is described here.)

Timeline for d1drw_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1drw_1