![]() | Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
![]() | Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily) |
![]() | Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) ![]() |
![]() | Family d.81.1.3: Dihydrodipicolinate reductase-like [55368] (2 proteins) |
![]() | Protein Dihydrodipicolinate reductase [55371] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [55372] (5 PDB entries) |
![]() | Domain d1dih_2: 1dih 131-240 [39971] Other proteins in same PDB: d1dih_1 |
PDB Entry: 1dih (more details), 2.2 Å
SCOP Domain Sequences for d1dih_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dih_2 d.81.1.3 (131-240) Dihydrodipicolinate reductase {Escherichia coli} vgvnvmlkllekaakvmgdytdieiieahhrhkvdapsgtalamgeaiahaldkdlkdca vysreghtgervpgtigfatvragdivgehtamfadigerleithkassr
Timeline for d1dih_2: