Lineage for d6lpda_ (6lpd A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2314150Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2314151Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2314152Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2315402Protein automated matches [190041] (34 species)
    not a true protein
  7. 2316093Species Phascolosoma esculenta [TaxId:419950] [399640] (2 PDB entries)
  8. 2316094Domain d6lpda_: 6lpd A: [399677]
    automated match to d5xhoa_
    complexed with fe, fe2

Details for d6lpda_

PDB Entry: 6lpd (more details), 1.65 Å

PDB Description: phascolosoma esculenta
PDB Compounds: (A:) Ferritin

SCOPe Domain Sequences for d6lpda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6lpda_ a.25.1.1 (A:) automated matches {Phascolosoma esculenta [TaxId: 419950]}
slsrprqnyhtesesavnkqinlelyasyvyqsmsryfnrddvalkgfhkyfkkaseeer
qhaeklmeyqstrggrimlsdikrpendewgtgleametalnleknvnqslldlhktaek
hvdaqmqdfieenflreqvesikeisdhitnlkrvgpglgeymfdknlse

SCOPe Domain Coordinates for d6lpda_:

Click to download the PDB-style file with coordinates for d6lpda_.
(The format of our PDB-style files is described here.)

Timeline for d6lpda_: