SCOPe 2.08: Domain d7ljcn1: 7ljc N:1-126

Lineage for d7ljcn1 (7ljc N:1-126)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [189241] (37 PDB entries)

8. Domain d7ljcn1: 7ljc N:1-126 [399667]
   Other proteins in same PDB: d7ljcb_, d7ljcg_, d7ljcn2
   automated match to d4ygab_
   complexed with clr, g4c, plm, sk0

Details for d7ljcn1

PDB Entry: 7ljc, 3 Å

PDB Description: allosteric modulator ly3154207 binding to skf-81297-bound dopamine receptor 1 in complex with minigs protein

PDB Compounds: (N:) Nanoboy 35

SCOPe Domain Sequences for d7ljcn1:

Sequence; same for both SEQRES and ATOM records:

>d7ljcn1 b.1.1.0 (N:1-126) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvqlqesggglvqpggslrlscaasgftfsnykmnwvrqapgkglewvsdisqsgasisy
tgsvkgrftisrdnakntlylqmnslkpedtavyycarcpapftrdcfdvtsttyayrgq
gtqvtv

Timeline for d7ljcn1:

• d7ljcn1 first appeared in SCOPe 2.07