Class a: All alpha proteins [46456] (290 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.1: Ferritin [47241] (10 proteins) |
Protein automated matches [190041] (34 species) not a true protein |
Species Phascolosoma esculenta [TaxId:419950] [399640] (2 PDB entries) |
Domain d6lpeb_: 6lpe B: [399666] automated match to d5up8a_ complexed with mg, so4 |
PDB Entry: 6lpe (more details), 1.99 Å
SCOPe Domain Sequences for d6lpeb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6lpeb_ a.25.1.1 (B:) automated matches {Phascolosoma esculenta [TaxId: 419950]} slsrprqnyhaesesgvnkqinlelyasyvyqsmawyfdrddvalkgfhkffkkaseeer ehaeklmkfqnqrggrivlsdikrpdhdewgtgleamevalnleknvnqslldlhkvaek ngddqmqdwieshflteqveaikelsdhitnlkrvgpglgeymfdketldgd
Timeline for d6lpeb_: