Lineage for d6lpeb_ (6lpe B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2700839Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2702255Protein automated matches [190041] (34 species)
    not a true protein
  7. 2702778Species Phascolosoma esculenta [TaxId:419950] [399640] (2 PDB entries)
  8. 2702786Domain d6lpeb_: 6lpe B: [399666]
    automated match to d5up8a_
    complexed with mg, so4

Details for d6lpeb_

PDB Entry: 6lpe (more details), 1.99 Å

PDB Description: phascolosoma esculenta ferritin
PDB Compounds: (B:) Ferritin

SCOPe Domain Sequences for d6lpeb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6lpeb_ a.25.1.1 (B:) automated matches {Phascolosoma esculenta [TaxId: 419950]}
slsrprqnyhaesesgvnkqinlelyasyvyqsmawyfdrddvalkgfhkffkkaseeer
ehaeklmkfqnqrggrivlsdikrpdhdewgtgleamevalnleknvnqslldlhkvaek
ngddqmqdwieshflteqveaikelsdhitnlkrvgpglgeymfdketldgd

SCOPe Domain Coordinates for d6lpeb_:

Click to download the PDB-style file with coordinates for d6lpeb_.
(The format of our PDB-style files is described here.)

Timeline for d6lpeb_: