Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies) core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1 |
Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) N-terminal domain is the classic Rossmann-fold |
Family d.81.1.3: Dihydrodipicolinate reductase-like [55368] (6 proteins) |
Protein Diaminopimelic acid dehydrogenase (DAPDH) [55369] (1 species) distantly related to dihydrodipicolinate reductase larger alpha+beta subdomain substitutes for one helix and one strand of the common fold |
Species Corynebacterium glutamicum [TaxId:1718] [55370] (4 PDB entries) |
Domain d3dapa2: 3dap A:119-268 [39966] Other proteins in same PDB: d3dapa1, d3dapb1 complexed with da3, ndp |
PDB Entry: 3dap (more details), 2.2 Å
SCOPe Domain Sequences for d3dapa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dapa2 d.81.1.3 (A:119-268) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} wdpgmfsinrvyaaavlaehqqhtfwgpglsqghsdalrripgvqkavqytlpsedalek arrgeagdltgkqthkrqcfvvadaadheriendirtmpdyfvgyevevnfideatfdse htgmphgghvittgdtggfnhtveyilkld
Timeline for d3dapa2: