Lineage for d3dapa2 (3dap A:119-268)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1659008Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 1659009Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 1659397Family d.81.1.3: Dihydrodipicolinate reductase-like [55368] (6 proteins)
  6. 1659430Protein Diaminopimelic acid dehydrogenase (DAPDH) [55369] (1 species)
    distantly related to dihydrodipicolinate reductase
    larger alpha+beta subdomain substitutes for one helix and one strand of the common fold
  7. 1659431Species Corynebacterium glutamicum [TaxId:1718] [55370] (4 PDB entries)
  8. 1659434Domain d3dapa2: 3dap A:119-268 [39966]
    Other proteins in same PDB: d3dapa1, d3dapb1
    complexed with da3, ndp

Details for d3dapa2

PDB Entry: 3dap (more details), 2.2 Å

PDB Description: c. glutamicum dap dehydrogenase in complex with nadp+ and the inhibitor 5s-isoxazoline
PDB Compounds: (A:) diaminopimelic acid dehydrogenase

SCOPe Domain Sequences for d3dapa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dapa2 d.81.1.3 (A:119-268) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]}
wdpgmfsinrvyaaavlaehqqhtfwgpglsqghsdalrripgvqkavqytlpsedalek
arrgeagdltgkqthkrqcfvvadaadheriendirtmpdyfvgyevevnfideatfdse
htgmphgghvittgdtggfnhtveyilkld

SCOPe Domain Coordinates for d3dapa2:

Click to download the PDB-style file with coordinates for d3dapa2.
(The format of our PDB-style files is described here.)

Timeline for d3dapa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3dapa1