SCOPe 2.07: Domain d6ll0c2: 6ll0 C:143-384

Lineage for d6ll0c2 (6ll0 C:143-384)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (11 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.3: Ring hydroxylating alpha subunit catalytic domain [55969] (7 proteins)
   Pfam PF00848; contains a few insertion and C-terminal extension compared with Bet v1

6. Protein automated matches [319939] (2 species)
   not a true protein

7. Species Janthinobacterium sp. [TaxId:213804] [399623] (9 PDB entries)

8. Domain d6ll0c2: 6ll0 C:143-384 [399643]
   Other proteins in same PDB: d6ll0a1, d6ll0b1, d6ll0c1
   automated match to d2de6a2
   complexed with 9ca, edo, fe2, fes, mg, peg, pge

Details for d6ll0c2

PDB Entry: 6ll0, 2.2 Å

PDB Description: carbazole-soaked reduced oxygenase in carbazole 1,9a-dioxygenase

PDB Compounds: (C:) terminal oxygenase component of carbazole

SCOPe Domain Sequences for d6ll0c2:

Sequence; same for both SEQRES and ATOM records:

>d6ll0c2 d.129.3.3 (C:143-384) automated matches {Janthinobacterium sp. [TaxId: 213804]}
pplardtppnfldddmeilgknqiiksnwrlavengfdpshiyihkdsilvkdndlalpl
gfapggdrkqqtrvvdddvvgrkgvydligehgvpvfegtiggevvregaygekivandi
siwlpgvlkvnpfpnpdmmqfewyvpidenthyyfqtlgkpcandeerkkyeqefeskwk
pmalegfnnddiwareamvdfyaddkgwvneilfesdeaivawrklasehnqgiqtqahv
sg

Timeline for d6ll0c2:

• d6ll0c2 is new in SCOPe 2.07-stable
  
• d6ll0c2 appears in the current release, SCOPe 2.08