Lineage for d1e5lb2 (1e5l B:125-391)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1210563Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 1210564Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 1210885Family d.81.1.2: Homoserine dehydrogenase-like [55363] (2 proteins)
  6. 1210898Protein Saccharopine reductase [55366] (1 species)
    contains an alpha-helical subdomain inserted in the common fold and other additional secondary structures
  7. 1210899Species Fungus (Magnaporthe grisea) [TaxId:148305] [55367] (3 PDB entries)
  8. 1210910Domain d1e5lb2: 1e5l B:125-391 [39964]
    Other proteins in same PDB: d1e5la1, d1e5lb1

Details for d1e5lb2

PDB Entry: 1e5l (more details), 2.4 Å

PDB Description: apo saccharopine reductase from magnaporthe grisea
PDB Compounds: (B:) saccharopine reductase

SCOPe Domain Sequences for d1e5lb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e5lb2 d.81.1.2 (B:125-391) Saccharopine reductase {Fungus (Magnaporthe grisea) [TaxId: 148305]}
ldpgidhlyaiktieevhaaggkiktflsycgglpapessdnplgykfswssrgvllalr
naasfykdgkvtnvagpelmatakpyfiypgfafvaypnrdstpykeryqipeadnivrg
tlryqgfpqfikvlvdigflsdeeqpflkeaipwkeatqkivkassaseqdivstivsna
tfesteeqkrivaglkwlgifsdkkitprgnaldtlcatleekmqfeegerdlvmlqhkf
eienkdgsretrtsslceygapigsgg

SCOPe Domain Coordinates for d1e5lb2:

Click to download the PDB-style file with coordinates for d1e5lb2.
(The format of our PDB-style files is described here.)

Timeline for d1e5lb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e5lb1