SCOP 1.69: Domain d1e5lb2: 1e5l B:125-391

Lineage for d1e5lb2 (1e5l B:125-391)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
   core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1

4. Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families)
   N-terminal domain is the classic Rossmann-fold

5. Family d.81.1.2: Homoserine dehydrogenase-like [55363] (2 proteins)

6. Protein Saccharopine reductase [55366] (1 species)
   contains an alpha-helical subdomain inserted in the common fold and other additional secondary structures

7. Species Rice blast fungus (Magnaporthe grisea) [TaxId:148305] [55367] (3 PDB entries)

8. Domain d1e5lb2: 1e5l B:125-391 [39964]
   Other proteins in same PDB: d1e5la1, d1e5lb1

Details for d1e5lb2

PDB Entry: 1e5l, 2.4 Å

PDB Description: apo saccharopine reductase from magnaporthe grisea

SCOP Domain Sequences for d1e5lb2:

Sequence; same for both SEQRES and ATOM records:

>d1e5lb2 d.81.1.2 (B:125-391) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea)}
ldpgidhlyaiktieevhaaggkiktflsycgglpapessdnplgykfswssrgvllalr
naasfykdgkvtnvagpelmatakpyfiypgfafvaypnrdstpykeryqipeadnivrg
tlryqgfpqfikvlvdigflsdeeqpflkeaipwkeatqkivkassaseqdivstivsna
tfesteeqkrivaglkwlgifsdkkitprgnaldtlcatleekmqfeegerdlvmlqhkf
eienkdgsretrtsslceygapigsgg

Timeline for d1e5lb2:

• d1e5lb2 first appeared (with stable ids) in SCOP 1.55
  
• d1e5lb2 appears in SCOP 1.67
  
• d1e5lb2 appears in SCOP 1.71
  
• d1e5lb2 appears in the current release, SCOPe 2.08