Lineage for d1e5qg2 (1e5q G:125-391)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily) Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) 
Family d.81.1.2: Homoserine dehydrogenase-like [55363] (2 proteins) Protein Saccharopine reductase [55366] (1 species) Species Rice blast fungus (Magnaporthe grisea) [TaxId:148305] [55367] (3 PDB entries) 
Domain d1e5qg2: 1e5q G:125-391 [39961]
Other proteins in same PDB: d1e5qa1, d1e5qb1, d1e5qc1, d1e5qd1, d1e5qe1, d1e5qf1, d1e5qg1, d1e5qh1
Details for d1e5qg2
PDB Entry: 1e5q (more details), 2.1 Å
PDB Description: ternary complex of saccharopine reductase from magnaporthe grisea, nadph and saccharopine
SCOP Domain Sequences for d1e5qg2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e5qg2 d.81.1.2 (G:125-391) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea)}
ldpgidhlyaiktieevhaaggkiktflsycgglpapessdnplgykfswssrgvllalr
naasfykdgkvtnvagpelmatakpyfiypgfafvaypnrdstpykeryqipeadnivrg
tlryqgfpqfikvlvdigflsdeeqpflkeaipwkeatqkivkassaseqdivstivsna
tfesteeqkrivaglkwlgifsdkkitprgnaldtlcatleekmqfeegerdlvmlqhkf
eienkdgsretrtsslceygapigsgg
SCOP Domain Coordinates for d1e5qg2:
Click to download the PDB-style file with coordinates for d1e5qg2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1e5qg2:
View in 3D
