Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.86: Phosphoglycerate kinase [53747] (1 superfamily) consists of two non-similar domains, 3 layers (a/b/a) each Domain 1 has parallel beta-sheet of 6 strands, order 342156 Domain 2 has parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.86.1: Phosphoglycerate kinase [53748] (2 families) |
Family c.86.1.0: automated matches [191414] (1 protein) not a true family |
Protein automated matches [190573] (6 species) not a true protein |
Species Mycobacterium avium [TaxId:243243] [399489] (1 PDB entry) |
Domain d7la1c_: 7la1 C: [399598] Other proteins in same PDB: d7la1b2 automated match to d1phpa_ complexed with edo |
PDB Entry: 7la1 (more details), 1.6 Å
SCOPe Domain Sequences for d7la1c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7la1c_ c.86.1.0 (C:) automated matches {Mycobacterium avium [TaxId: 243243]} mvavhnlkdllaegvsgrgvlvrsdlnvpldsdgeqgritdpgritasvptlsalveaga kvvvaahlgrpkngpdpalslapvaaalgeqlgrhvqlasdvvgtdalaraegltdgdvl llenirfdaretskddaerlalarqlaelvgptgafvsdgfgvvhrkqasvydvatllph yagtlvaeeiavleqltgstkrpyavvlggskvsdklgvieslatkadsivigggmcftf laaqgfsvgkslletemvdtcrrlldtyvdvlrlpvdivaadrfaadaapqtvpadaipd dlmgldigpgsvkrftallsnaetifwngpmgvfefpafaagtkglaeaiaaatgkgafs vvgggdsaaavralgipesgfshistgggasleylegkalpgievlgrpqpt
Timeline for d7la1c_:
View in 3D Domains from other chains: (mouse over for more information) d7la1a_, d7la1b1, d7la1b2, d7la1d_ |