Lineage for d1e5qe2 (1e5q E:125-391)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 33775Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
  4. 33776Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
  5. 33875Family d.81.1.2: Homoserine dehydrogenase-like [55363] (2 proteins)
  6. 33884Protein Saccharopine reductase [55366] (1 species)
  7. 33885Species Rice blast fungus (Magnaporthe grisea) [TaxId:148305] [55367] (3 PDB entries)
  8. 33891Domain d1e5qe2: 1e5q E:125-391 [39959]
    Other proteins in same PDB: d1e5qa1, d1e5qb1, d1e5qc1, d1e5qd1, d1e5qe1, d1e5qf1, d1e5qg1, d1e5qh1

Details for d1e5qe2

PDB Entry: 1e5q (more details), 2.1 Å

PDB Description: ternary complex of saccharopine reductase from magnaporthe grisea, nadph and saccharopine

SCOP Domain Sequences for d1e5qe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e5qe2 d.81.1.2 (E:125-391) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea)}
ldpgidhlyaiktieevhaaggkiktflsycgglpapessdnplgykfswssrgvllalr
naasfykdgkvtnvagpelmatakpyfiypgfafvaypnrdstpykeryqipeadnivrg
tlryqgfpqfikvlvdigflsdeeqpflkeaipwkeatqkivkassaseqdivstivsna
tfesteeqkrivaglkwlgifsdkkitprgnaldtlcatleekmqfeegerdlvmlqhkf
eienkdgsretrtsslceygapigsgg

SCOP Domain Coordinates for d1e5qe2:

Click to download the PDB-style file with coordinates for d1e5qe2.
(The format of our PDB-style files is described here.)

Timeline for d1e5qe2: