Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) |
Family b.1.4.0: automated matches [254272] (1 protein) not a true family |
Protein automated matches [254633] (16 species) not a true protein |
Species Escherichia coli [TaxId:83333] [272134] (17 PDB entries) |
Domain d6lejb2: 6lej B:182-273 [399586] Other proteins in same PDB: d6leja1, d6leja3, d6leja4, d6lejb1, d6lejb3 automated match to d3lpfa2 complexed with ckx |
PDB Entry: 6lej (more details), 2.62 Å
SCOPe Domain Sequences for d6lejb2:
Sequence, based on SEQRES records: (download)
>d6lejb2 b.1.4.0 (B:182-273) automated matches {Escherichia coli [TaxId: 83333]} twvdditvvthvaqdcnhasvdwqvvangdvsvelrdadqqvvatgqgtsgtlqvvnphl wqpgegylyelcvtaksqtecdiyplrvgirs
>d6lejb2 b.1.4.0 (B:182-273) automated matches {Escherichia coli [TaxId: 83333]} twvdditvvthvaqasvdwqvvangdvsvelrdadqqvvatgqgtsgtlqvvgegylyel cvtaksqtecdiyplrvgirs
Timeline for d6lejb2:
View in 3D Domains from other chains: (mouse over for more information) d6leja1, d6leja2, d6leja3, d6leja4 |