Lineage for d1e5qd2 (1e5q D:125-391)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2961609Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 2961610Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 2961986Family d.81.1.2: Homoserine dehydrogenase-like [55363] (2 proteins)
  6. 2961999Protein Saccharopine reductase [55366] (1 species)
    contains an alpha-helical subdomain inserted in the common fold and other additional secondary structures
  7. 2962000Species Fungus (Magnaporthe grisea) [TaxId:148305] [55367] (3 PDB entries)
  8. 2962005Domain d1e5qd2: 1e5q D:125-391 [39958]
    Other proteins in same PDB: d1e5qa1, d1e5qb1, d1e5qc1, d1e5qd1, d1e5qe1, d1e5qf1, d1e5qg1, d1e5qh1
    complexed with ndp, shr

Details for d1e5qd2

PDB Entry: 1e5q (more details), 2.1 Å

PDB Description: ternary complex of saccharopine reductase from magnaporthe grisea, nadph and saccharopine
PDB Compounds: (D:) Saccharopine dehydrogenase [NADP(+), L-glutamate-forming]

SCOPe Domain Sequences for d1e5qd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e5qd2 d.81.1.2 (D:125-391) Saccharopine reductase {Fungus (Magnaporthe grisea) [TaxId: 148305]}
ldpgidhlyaiktieevhaaggkiktflsycgglpapessdnplgykfswssrgvllalr
naasfykdgkvtnvagpelmatakpyfiypgfafvaypnrdstpykeryqipeadnivrg
tlryqgfpqfikvlvdigflsdeeqpflkeaipwkeatqkivkassaseqdivstivsna
tfesteeqkrivaglkwlgifsdkkitprgnaldtlcatleekmqfeegerdlvmlqhkf
eienkdgsretrtsslceygapigsgg

SCOPe Domain Coordinates for d1e5qd2:

Click to download the PDB-style file with coordinates for d1e5qd2.
(The format of our PDB-style files is described here.)

Timeline for d1e5qd2: