![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
![]() | Superfamily a.22.1: Histone-fold [47113] (5 families) ![]() |
![]() | Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
![]() | Protein Histone H3 [47122] (6 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187038] (23 PDB entries) |
![]() | Domain d6l9ze_: 6l9z E: [399557] Other proteins in same PDB: d6l9zb_, d6l9zc_, d6l9zd_, d6l9zf_, d6l9zg_, d6l9zh_, d6l9zl_, d6l9zm_, d6l9zn_, d6l9zp_, d6l9zq_, d6l9zr_, d6l9zs_ automated match to d1u35a1 protein/DNA complex; complexed with ca, cl, k |
PDB Entry: 6l9z (more details), 2.5 Å
SCOPe Domain Sequences for d6l9ze_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6l9ze_ a.22.1.1 (E:) Histone H3 {Human (Homo sapiens) [TaxId: 9606]} kkphryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqea ceaylvglfedtnlcaihakrvtimpkdiqlarrirgera
Timeline for d6l9ze_: