SCOPe 2.08: Domain d6lbmc1: 6lbm C:72-168

Lineage for d6lbmc1 (6lbm C:72-168)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.14: Forkhead DNA-binding domain [46832] (7 proteins)

6. Protein automated matches [190243] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187016] (11 PDB entries)

8. Domain d6lbmc1: 6lbm C:72-168 [399553]
   Other proteins in same PDB: d6lbmc2
   automated match to d1vtnc_
   complexed with mg

Details for d6lbmc1

PDB Entry: 6lbm, 2.84 Å

PDB Description: crystal structure of foxc2-dbd bound to a palindromic dna sequence

PDB Compounds: (C:) Forkhead box protein C2

SCOPe Domain Sequences for d6lbmc1:

Sequence, based on SEQRES records:

>d6lbmc1 a.4.5.14 (C:72-168) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kppysyialitmaiqnapekkitlngiyqfimdrfpfyrenkqgwqnsirhnlslnecfv
kvprddkkpgkgsywtldpdsynmfengsflrrrrrf

Sequence, based on observed residues (ATOM records):

>d6lbmc1 a.4.5.14 (C:72-168) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kppysyialitmaiqnapekkitlngiyqfimdrfpfyrenkqgwqnsirhnlslnecfv
kvprddkkgsywtldpdsynmfengsflrrrrrf

Timeline for d6lbmc1:

• d6lbmc1 first appeared in SCOPe 2.07