Lineage for d6lega3 (6leg A:274-601)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2832343Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2832344Protein automated matches [190075] (132 species)
    not a true protein
  7. 2832649Species Escherichia coli [TaxId:562] [399550] (1 PDB entry)
  8. 2832650Domain d6lega3: 6leg A:274-601 [399551]
    Other proteins in same PDB: d6lega1, d6lega2, d6lega4, d6legb1, d6legb2, d6legb4, d6legc1, d6legc2, d6legc4, d6legd1, d6legd2, d6legd4
    automated match to d3lpfa3
    complexed with sj5

Details for d6lega3

PDB Entry: 6leg (more details), 2.6 Å

PDB Description: structure of e. coli beta-glucuronidase complex with uronic isofagomine
PDB Compounds: (A:) Beta-D-glucuronidase

SCOPe Domain Sequences for d6lega3:

Sequence; same for both SEQRES and ATOM records: (download)

>d6lega3 c.1.8.0 (A:274-601) automated matches {Escherichia coli [TaxId: 562]}
vavkgeqflinhkpfyftgfgrhedadlrgkgfdnvlmvhdhalmdwigansyrtshypy
aeemldwadehgivvidetaavgfnlslgigfeagnkpkelyseeavngetqqahlqaik
eliardknhpsvvmwsianepdtrpqgareyfaplaeatrkldptrpitcvnvmfcdaht
dtisdlfdvlclnryygwyvqsgdletaekvlekellawqeklhqpiiiteygvdtlagl
hsmytdmwseeyqcawldmyhrvfdrvsavvgeqvwnfadfatsqgilrvggnkkgiftr
drkpksaafllqkrwtgmnfgekpqqgg

SCOPe Domain Coordinates for d6lega3:

Click to download the PDB-style file with coordinates for d6lega3.
(The format of our PDB-style files is described here.)

Timeline for d6lega3: