Lineage for d1ff9a2 (1ff9 A:125-391)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily) Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) 
Family d.81.1.2: Homoserine dehydrogenase-like [55363] (2 proteins) Protein Saccharopine reductase [55366] (1 species) Species Rice blast fungus (Magnaporthe grisea) [TaxId:148305] [55367] (3 PDB entries) 
Domain d1ff9a2: 1ff9 A:125-391 [39954]
Other proteins in same PDB: d1ff9a1
Details for d1ff9a2
PDB Entry: 1ff9 (more details), 2 Å
PDB Description: apo saccharopine reductase
SCOP Domain Sequences for d1ff9a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ff9a2 d.81.1.2 (A:125-391) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea)}
ldpgidhlyaiktieevhaaggkiktflsycgglpapessdnplgykfswssrgvllalr
naasfykdgkvtnvagpelmatakpyfiypgfafvaypnrdstpykeryqipeadnivrg
tlryqgfpqfikvlvdigflsdeeqpflkeaipwkeatqkivkassaseqdivstivsna
tfesteeqkrivaglkwlgifsdkkitprgnaldtlcatleekmqfeegerdlvmlqhkf
eienkdgsretrtsslceygapigsgg
SCOP Domain Coordinates for d1ff9a2:
Click to download the PDB-style file with coordinates for d1ff9a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ff9a2:
- d1ff9a2 appears in SCOP 1.57
- d1ff9a2 appears in the current release, SCOPe 2.08
View in 3D
