Lineage for d1ff9a2 (1ff9 A:125-391)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2527131Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 2527132Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 2527500Family d.81.1.2: Homoserine dehydrogenase-like [55363] (2 proteins)
  6. 2527513Protein Saccharopine reductase [55366] (1 species)
    contains an alpha-helical subdomain inserted in the common fold and other additional secondary structures
  7. 2527514Species Fungus (Magnaporthe grisea) [TaxId:148305] [55367] (3 PDB entries)
  8. 2527525Domain d1ff9a2: 1ff9 A:125-391 [39954]
    Other proteins in same PDB: d1ff9a1
    complexed with so4

Details for d1ff9a2

PDB Entry: 1ff9 (more details), 2 Å

PDB Description: apo saccharopine reductase
PDB Compounds: (A:) saccharopine reductase

SCOPe Domain Sequences for d1ff9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ff9a2 d.81.1.2 (A:125-391) Saccharopine reductase {Fungus (Magnaporthe grisea) [TaxId: 148305]}
ldpgidhlyaiktieevhaaggkiktflsycgglpapessdnplgykfswssrgvllalr
naasfykdgkvtnvagpelmatakpyfiypgfafvaypnrdstpykeryqipeadnivrg
tlryqgfpqfikvlvdigflsdeeqpflkeaipwkeatqkivkassaseqdivstivsna
tfesteeqkrivaglkwlgifsdkkitprgnaldtlcatleekmqfeegerdlvmlqhkf
eienkdgsretrtsslceygapigsgg

SCOPe Domain Coordinates for d1ff9a2:

Click to download the PDB-style file with coordinates for d1ff9a2.
(The format of our PDB-style files is described here.)

Timeline for d1ff9a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ff9a1