Lineage for d7l6sa1 (7l6s A:119-364)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2973214Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2973215Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2973995Family d.122.1.0: automated matches [227160] (1 protein)
    not a true family
  6. 2973996Protein automated matches [226867] (22 species)
    not a true protein
  7. 2974000Species Balamuthia mandrillaris [TaxId:66527] [399532] (1 PDB entry)
  8. 2974001Domain d7l6sa1: 7l6s A:119-364 [399533]
    Other proteins in same PDB: d7l6sa2
    automated match to d1pvga2
    complexed with anp, edo, mg

Details for d7l6sa1

PDB Entry: 7l6s (more details), 1.95 Å

PDB Description: crystal structure of the atpase and transducer domains of dna topoisomerase ii from balamuthia mandrillaris cdc:v039: baboon/san diego/1986
PDB Compounds: (A:) DNA topoisomerase II

SCOPe Domain Sequences for d7l6sa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7l6sa1 d.122.1.0 (A:119-364) automated matches {Balamuthia mandrillaris [TaxId: 66527]}
ktpeelyqkktpiehvllrpdtylgsvlrttepgmwvydpdsrrmverectyvpalykif
deilvnaadnkqrdpntstievnidadtntisvfndgrgipvhvhktegmylpemlfghl
ltssnyddseakvtggrngygakltniyskeftvetvdcerglrfqqtwrdnmsvreepl
itplspeekahgdytkitfrpdlsrldsmhslrdgdiigvmsrrafdvaacnegldvyln
geklps

SCOPe Domain Coordinates for d7l6sa1:

Click to download the PDB-style file with coordinates for d7l6sa1.
(The format of our PDB-style files is described here.)

Timeline for d7l6sa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d7l6sa2