| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) ![]() |
| Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
| Protein Histone H4 [47125] (7 species) |
| Species Human (Homo sapiens) [TaxId:9606] [192456] (59 PDB entries) |
| Domain d6l9zf_: 6l9z F: [399519] Other proteins in same PDB: d6l9za_, d6l9zc_, d6l9zd_, d6l9ze_, d6l9zg_, d6l9zh_, d6l9zk_, d6l9zm_, d6l9zn_, d6l9zo_, d6l9zq_, d6l9zr_, d6l9zs_ automated match to d1eqzd_ protein/DNA complex; complexed with ca, cl, k |
PDB Entry: 6l9z (more details), 2.5 Å
SCOPe Domain Sequences for d6l9zf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6l9zf_ a.22.1.1 (F:) Histone H4 {Human (Homo sapiens) [TaxId: 9606]}
krhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtyteh
akrktvtamdvvyalkrqgrtlygfgg
Timeline for d6l9zf_: