Class a: All alpha proteins [46456] (289 folds) |
Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) |
Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
Protein Histone H2A [47115] (6 species) |
Species Human (Homo sapiens), H2A.a [TaxId:9606] [140392] (5 PDB entries) Uniprot P28001 11-118 |
Domain d6l9zg_: 6l9z G: [399511] Other proteins in same PDB: d6l9za_, d6l9zb_, d6l9zd_, d6l9ze_, d6l9zf_, d6l9zh_, d6l9zk_, d6l9zl_, d6l9zn_, d6l9zo_, d6l9zp_, d6l9zr_ automated match to d2cv5c1 protein/DNA complex; complexed with ca, cl, k |
PDB Entry: 6l9z (more details), 2.5 Å
SCOPe Domain Sequences for d6l9zg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6l9zg_ a.22.1.1 (G:) Histone H2A {Human (Homo sapiens), H2A.a [TaxId: 9606]} kaktrssraglqfpvgrvhrllrkgnyservgagapvylaavleyltaeilelagnaard nkktriiprhlqlairndeelnkllgrvtiaqggvlpniqavllpkk
Timeline for d6l9zg_: