![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (29 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries) |
![]() | Domain d7l0nn1: 7l0n N:1-107 [399501] Other proteins in same PDB: d7l0nb1, d7l0nb2, d7l0nd1, d7l0nd2, d7l0ne_, d7l0nf_, d7l0nl2, d7l0nn2, d7l0nr_, d7l0ns_ automated match to d1dn0a1 complexed with cl, na, nag, pg4, pg5, pge, so4, zn |
PDB Entry: 7l0n (more details), 2.78 Å
SCOPe Domain Sequences for d7l0nn1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7l0nn1 b.1.1.0 (N:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]} diqmtqspsslsaavgdrvtitcrasqsigsylnwyqqkpgkapklliyaasslqsgvps rfsgsgsgtdftltisslqpedfaiyycqqsyvsptytfgpgtkvdi
Timeline for d7l0nn1: