SCOPe 2.07: Domain d7lbrb1: 7lbr B:1-61

Lineage for d7lbrb1 (7lbr B:1-61)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.0: automated matches [191343] (1 protein)
   not a true family

6. Protein automated matches [190233] (31 species)
   not a true protein

7. Species Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049] [383234] (33 PDB entries)

8. Domain d7lbrb1: 7lbr B:1-61 [399495]
   Other proteins in same PDB: d7lbra2, d7lbra3, d7lbrb2, d7lbrb3
   automated match to d5tl6b1
   complexed with gol, so4, xt7, zn

Details for d7lbrb1

PDB Entry: 7lbr, 2.2 Å

PDB Description: sars-cov-2 papain-like protease (plpro) bound to inhibitor xr8-89

PDB Compounds: (B:) non-structural protein 3

SCOPe Domain Sequences for d7lbrb1:

Sequence; same for both SEQRES and ATOM records:

>d7lbrb1 d.15.1.0 (B:1-61) automated matches {Severe acute respiratory syndrome coronavirus 2 [TaxId: 2697049]}
evrtikvfttvdninlhtqvvdmsmtygqqfgptyldgadvtkikphnshegktfyvlpn
d

Timeline for d7lbrb1:

• d7lbrb1 is new in SCOPe 2.07-stable
  
• d7lbrb1 appears in the current release, SCOPe 2.08