Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (17 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries) |
Domain d7l0nb2: 7l0n B:107-213 [399478] Other proteins in same PDB: d7l0nb1, d7l0nd1, d7l0ne_, d7l0nf_, d7l0nl1, d7l0nn1, d7l0nr_, d7l0ns_ automated match to d1dn0a2 complexed with cl, na, nag, pg4, pg5, pge, so4, zn |
PDB Entry: 7l0n (more details), 2.78 Å
SCOPe Domain Sequences for d7l0nb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d7l0nb2 b.1.1.2 (B:107-213) automated matches {Human (Homo sapiens) [TaxId: 9606]} krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge
Timeline for d7l0nb2: