Lineage for d7l0nb2 (7l0n B:107-213)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2751403Domain d7l0nb2: 7l0n B:107-213 [399478]
    Other proteins in same PDB: d7l0nb1, d7l0nd1, d7l0ne_, d7l0nf_, d7l0nh_, d7l0nl1, d7l0nm_, d7l0nn1, d7l0nr_, d7l0ns_
    automated match to d1dn0a2
    complexed with cl, na, nag, pg4, pg5, pge, so4, zn

Details for d7l0nb2

PDB Entry: 7l0n (more details), 2.78 Å

PDB Description: circulating sars-cov-2 spike n439k variants maintain fitness while evading antibody-mediated immunity
PDB Compounds: (B:) Monoclonal antibody S309 Fab light chain

SCOPe Domain Sequences for d7l0nb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7l0nb2 b.1.1.2 (B:107-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

SCOPe Domain Coordinates for d7l0nb2:

Click to download the PDB-style file with coordinates for d7l0nb2.
(The format of our PDB-style files is described here.)

Timeline for d7l0nb2: