| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
| Protein automated matches [190119] (24 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries) |
| Domain d7l0nb1: 7l0n B:1-106 [399477] Other proteins in same PDB: d7l0nb2, d7l0nd2, d7l0ne_, d7l0nf_, d7l0nl1, d7l0nl2, d7l0nn1, d7l0nn2, d7l0nr_, d7l0ns_ automated match to d1dn0a1 complexed with cl, na, nag, pg4, pg5, pge, so4, zn |
PDB Entry: 7l0n (more details), 2.78 Å
SCOPe Domain Sequences for d7l0nb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7l0nb1 b.1.1.1 (B:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivltqspgtlslspgeratlscrasqtvsstslawyqqkpgqaprlliygassratgip
drfsgsgsgtdftltisrlepedfavyycqqhdtsltfgggtkvei
Timeline for d7l0nb1: