SCOPe 2.08: Domain d7l0nb1: 7l0n B:1-106

Lineage for d7l0nb1 (7l0n B:1-106)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)

8. Domain d7l0nb1: 7l0n B:1-106 [399477]
   Other proteins in same PDB: d7l0nb2, d7l0nd2, d7l0ne_, d7l0nf_, d7l0nl1, d7l0nl2, d7l0nn1, d7l0nn2, d7l0nr_, d7l0ns_
   automated match to d1dn0a1
   complexed with cl, na, nag, pg4, pg5, pge, so4, zn

Details for d7l0nb1

PDB Entry: 7l0n, 2.78 Å

PDB Description: circulating sars-cov-2 spike n439k variants maintain fitness while evading antibody-mediated immunity

PDB Compounds: (B:) Monoclonal antibody S309 Fab light chain

SCOPe Domain Sequences for d7l0nb1:

Sequence; same for both SEQRES and ATOM records:

>d7l0nb1 b.1.1.1 (B:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivltqspgtlslspgeratlscrasqtvsstslawyqqkpgqaprlliygassratgip
drfsgsgsgtdftltisrlepedfavyycqqhdtsltfgggtkvei

Timeline for d7l0nb1:

• d7l0nb1 first appeared in SCOPe 2.07