SCOPe 2.08: Domain d6l9zr_: 6l9z R:

Lineage for d6l9zr_ (6l9z R:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (5 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein automated matches [193445] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [193446] (79 PDB entries)

8. Domain d6l9zr_: 6l9z R: [399469]
   Other proteins in same PDB: d6l9za_, d6l9zb_, d6l9zc_, d6l9ze_, d6l9zf_, d6l9zg_, d6l9zk_, d6l9zl_, d6l9zm_, d6l9zo_, d6l9zp_, d6l9zq_, d6l9zs_
   automated match to d5b2jd_
   protein/DNA complex; complexed with ca, cl, k

Details for d6l9zr_

PDB Entry: 6l9z, 2.5 Å

PDB Description: 338 bp di-nucleosome assembled with linker histone h1.x

PDB Compounds: (R:) Histone H2B type 1-J

SCOPe Domain Sequences for d6l9zr_:

Sequence; same for both SEQRES and ATOM records:

>d6l9zr_ a.22.1.1 (R:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krsrkesysiyvykvlkqvhpdtgisskamgimnsfvndiferiageasrlahynkrsti
tsreiqtavrlllpgelakhavsegtkavtkytsak

Timeline for d6l9zr_:

• d6l9zr_ first appeared in SCOPe 2.07