![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (2 families) ![]() |
![]() | Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (3 proteins) contain additional N-terminal strand "0", antiparallel to strand 2 |
![]() | Protein Succinyl-CoA synthetase, beta-chain, C-terminal domain [52215] (3 species) |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [52217] (13 PDB entries) |
![]() | Domain d7jmkd2: 7jmk D:246-393 [399465] Other proteins in same PDB: d7jmka1, d7jmka2, d7jmkb1, d7jmkc1, d7jmkc2, d7jmkd1 automated match to d2nu8e1 complexed with gdp, mg |
PDB Entry: 7jmk (more details), 2.5 Å
SCOPe Domain Sequences for d7jmkd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d7jmkd2 c.23.4.1 (D:246-393) Succinyl-CoA synthetase, beta-chain, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} epieneaakydlkyigldgniacfvngaglamatcdiiflnggkpanfldlgggvkesqv yqafklltadpkveailvnifggivncaiiangitkacrelelkvplvvrlegtnvheaq niltnsglpitsavdledaakkavasvt
Timeline for d7jmkd2: