Lineage for d6l9za_ (6l9z A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2698054Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2698055Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2698056Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 2698296Protein Histone H3 [47122] (6 species)
  7. 2698397Species Human (Homo sapiens) [TaxId:9606] [187038] (23 PDB entries)
  8. 2698430Domain d6l9za_: 6l9z A: [399460]
    Other proteins in same PDB: d6l9zb_, d6l9zc_, d6l9zd_, d6l9zf_, d6l9zg_, d6l9zh_, d6l9zl_, d6l9zm_, d6l9zn_, d6l9zp_, d6l9zq_, d6l9zr_, d6l9zs_
    automated match to d1u35a1
    protein/DNA complex; complexed with ca, cl, k

Details for d6l9za_

PDB Entry: 6l9z (more details), 2.5 Å

PDB Description: 338 bp di-nucleosome assembled with linker histone h1.x
PDB Compounds: (A:) Histone H3.1

SCOPe Domain Sequences for d6l9za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6l9za_ a.22.1.1 (A:) Histone H3 {Human (Homo sapiens) [TaxId: 9606]}
phryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeace
aylvglfedtnlcaihakrvtimpkdiqlarrirgera

SCOPe Domain Coordinates for d6l9za_:

Click to download the PDB-style file with coordinates for d6l9za_.
(The format of our PDB-style files is described here.)

Timeline for d6l9za_: