SCOPe 2.08: Domain d7jtwa1: 7jtw A:265-508

Lineage for d7jtwa1 (7jtw A:265-508)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
   multihelical; 3 layers or orthogonally packed helices

4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families)

5. Family a.123.1.0: automated matches [191623] (1 protein)
   not a true family

6. Protein automated matches [191142] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189274] (121 PDB entries)

8. Domain d7jtwa1: 7jtw A:265-508 [399451]
   Other proteins in same PDB: d7jtwa2
   automated match to d5ntwa_
   complexed with gol, so4, vk4

Details for d7jtwa1

PDB Entry: 7jtw, 1.9 Å

PDB Description: crystal structure of rorgt with compound (4r)-6-[(2,5-dichloro-3- {[(2r,4r)-1-(cyclopentanecarbonyl)-2-methylpiperidin-4- yl]oxy}phenyl)amino]-6-oxo-4-phenylhexanoic acid

PDB Compounds: (A:) RAR-related orphan receptor C isoform a variant

SCOPe Domain Sequences for d7jtwa1:

Sequence; same for both SEQRES and ATOM records:

>d7jtwa1 a.123.1.0 (A:265-508) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhl
teaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkygg
melfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqy
nlelafhhhlckthrqsilaklppkgklrslcsqhvermqifqhlhpivvqaafpplyke
lfst

Timeline for d7jtwa1:

• d7jtwa1 first appeared in SCOPe 2.07