Lineage for d1brma2 (1brm A:134-354)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1915719Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 1915720Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 1915721Family d.81.1.1: GAPDH-like [55348] (6 proteins)
    has many additional secondary structures
  6. 1915728Protein Aspartate beta-semialdehyde dehydrogenase [55361] (4 species)
  7. 1915729Species Escherichia coli [TaxId:562] [55362] (4 PDB entries)
    Uniprot P00353
  8. 1915737Domain d1brma2: 1brm A:134-354 [39945]
    Other proteins in same PDB: d1brma1, d1brmb1, d1brmc1

Details for d1brma2

PDB Entry: 1brm (more details), 2.5 Å

PDB Description: aspartate beta-semialdehyde dehydrogenase from escherichia coli
PDB Compounds: (A:) aspartate-semialdehyde dehydrogenase

SCOPe Domain Sequences for d1brma2:

Sequence, based on SEQRES records: (download)

>d1brma2 d.81.1.1 (A:134-354) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]}
nctvslmlmslgglfandlvdwvsvatyqaasgggarhmrelltqmghlyghvadelatp
ssaildierkvttltrsgelpvdnfgvplagslipwidkqldngqsreewkgqaetnkil
ntssvipvdglcvrvgalrchsqaftiklkkdvsiptveellaahnpwakvvpndreitm
reltpaavtgtlttpvgrlrklnmgpeflsaftvgdqllwg

Sequence, based on observed residues (ATOM records): (download)

>d1brma2 d.81.1.1 (A:134-354) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]}
nctvslmlmslgglfandlvdwvsvatyqaasgggarhmrelltqmghlyghvadelatp
ssaildierkvttltrsgelpvdnfgvplagslipwidwkgqaetnkilntssvipvdgl
cvrvgalrchsqaftiklkkdvsiptveellaahnpwakvvpndreitmreltpaavtgt
lttpvgrlrklnmgpeflsaftvgdqllwg

SCOPe Domain Coordinates for d1brma2:

Click to download the PDB-style file with coordinates for d1brma2.
(The format of our PDB-style files is described here.)

Timeline for d1brma2: