Lineage for d3gpdg2 (3gpd G:151-314)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1421944Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 1421945Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 1421946Family d.81.1.1: GAPDH-like [55348] (6 proteins)
    has many additional secondary structures
  6. 1422023Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (19 species)
  7. 1422099Species Human (Homo sapiens) [TaxId:9606] [55360] (1 PDB entry)
  8. 1422100Domain d3gpdg2: 3gpd G:151-314 [39944]
    Other proteins in same PDB: d3gpdg1, d3gpdr1
    complexed with nad, so4

Details for d3gpdg2

PDB Entry: 3gpd (more details), 3.5 Å

PDB Description: twinning in crystals of human skeletal muscle d-glyceraldehyde-3- phosphate dehydrogenase
PDB Compounds: (G:) d-glyceraldehyde-3-phosphate dehydrogenase

SCOPe Domain Sequences for d3gpdg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gpdg2 d.81.1.1 (G:151-314) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human (Homo sapiens) [TaxId: 9606]}
cttnclaplakvihdhfgiveglmttvhaitatqktvdspsgklwrggrgaaqnlipast
gaakavgkvipeldgkltgmafrvptanvsvldltcrlekpakyddikkvvkeasegplk
gilgytedevvsddfngsnhssifdagagielndtfvklvswyd

SCOPe Domain Coordinates for d3gpdg2:

Click to download the PDB-style file with coordinates for d3gpdg2.
(The format of our PDB-style files is described here.)

Timeline for d3gpdg2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3gpdg1