Lineage for d3gpdg2 (3gpd G:151-314)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 135038Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
  4. 135039Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
  5. 135040Family d.81.1.1: GAPDH-like [55348] (2 proteins)
  6. 135048Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (12 species)
  7. 135095Species Human (Homo sapiens) [TaxId:9606] [55360] (1 PDB entry)
  8. 135096Domain d3gpdg2: 3gpd G:151-314 [39944]
    Other proteins in same PDB: d3gpdg1, d3gpdr1

Details for d3gpdg2

PDB Entry: 3gpd (more details), 3.5 Å

PDB Description: twinning in crystals of human skeletal muscle d-glyceraldehyde-3- phosphate dehydrogenase

SCOP Domain Sequences for d3gpdg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gpdg2 d.81.1.1 (G:151-314) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human (Homo sapiens)}
cttnclaplakvihdhfgiveglmttvhaitatqktvdspsgklwrggrgaaqnlipast
gaakavgkvipeldgkltgmafrvptanvsvldltcrlekpakyddikkvvkeasegplk
gilgytedevvsddfngsnhssifdagagielndtfvklvswyd

SCOP Domain Coordinates for d3gpdg2:

Click to download the PDB-style file with coordinates for d3gpdg2.
(The format of our PDB-style files is described here.)

Timeline for d3gpdg2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3gpdg1