Lineage for d7l0ns_ (7l0n S:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2616505Fold d.318: SARS receptor-binding domain-like [143586] (1 superfamily)
    core: 3 layers, a/b/a; antiparallel beta-sheet of 5 strands, order 13542
  4. 2616506Superfamily d.318.1: SARS receptor-binding domain-like [143587] (1 family) (S)
    automatically mapped to Pfam PF09408
  5. 2616507Family d.318.1.1: SARS receptor-binding domain-like [143588] (1 protein)
    part of PfamB PB000266
  6. 2616508Protein Spike protein S1 [143589] (4 species)
  7. 2616541Species Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049] [382292] (92 PDB entries)
  8. 2616621Domain d7l0ns_: 7l0n S: [399434]
    Other proteins in same PDB: d7l0nb1, d7l0nb2, d7l0nd1, d7l0nd2, d7l0ne_, d7l0nf_, d7l0nl1, d7l0nl2, d7l0nn1, d7l0nn2
    automated match to d2dd8s1
    complexed with cl, na, nag, pg4, pg5, pge, so4, zn

Details for d7l0ns_

PDB Entry: 7l0n (more details), 2.78 Å

PDB Description: circulating sars-cov-2 spike n439k variants maintain fitness while evading antibody-mediated immunity
PDB Compounds: (S:) Spike protein S1

SCOPe Domain Sequences for d7l0ns_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7l0ns_ d.318.1.1 (S:) Spike protein S1 {Severe acute respiratory syndrome coronavirus 2 [TaxId: 2697049]}
rfpnitnlcpfgevfnatrfasvyawnrkrisncvadysvlynsasfstfkcygvsptkl
ndlcftnvyadsfvirgdevrqiapgqtgkiadynyklpddftgcviawnsknldskvgg
nynylyrlfrksnlkpferdisteiyqagstpcngvegfncyfplqsygfqptngvgyqp
yrvvvlsfellhapatvcgpk

SCOPe Domain Coordinates for d7l0ns_:

Click to download the PDB-style file with coordinates for d7l0ns_.
(The format of our PDB-style files is described here.)

Timeline for d7l0ns_: