Lineage for d3gpdr2 (3gpd R:151-314)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 331066Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 331067Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 331068Family d.81.1.1: GAPDH-like [55348] (3 proteins)
    has many additional secondary structures
  6. 331086Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (14 species)
  7. 331152Species Human (Homo sapiens) [TaxId:9606] [55360] (1 PDB entry)
  8. 331154Domain d3gpdr2: 3gpd R:151-314 [39943]
    Other proteins in same PDB: d3gpdg1, d3gpdr1

Details for d3gpdr2

PDB Entry: 3gpd (more details), 3.5 Å

PDB Description: twinning in crystals of human skeletal muscle d-glyceraldehyde-3- phosphate dehydrogenase

SCOP Domain Sequences for d3gpdr2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gpdr2 d.81.1.1 (R:151-314) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human (Homo sapiens)}
cttnclaplakvihdhfgiveglmttvhaitatqktvdspsgklwrggrgaaqnlipast
gaakavgkvipeldgkltgmafrvptanvsvldltcrlekpakyddikkvvkeasegplk
gilgytedevvsddfngsnhssifdagagielndtfvklvswyd

SCOP Domain Coordinates for d3gpdr2:

Click to download the PDB-style file with coordinates for d3gpdr2.
(The format of our PDB-style files is described here.)

Timeline for d3gpdr2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3gpdr1