Lineage for d1crwr2 (1crw R:149-312)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1915719Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 1915720Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 1915721Family d.81.1.1: GAPDH-like [55348] (6 proteins)
    has many additional secondary structures
  6. 1915812Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (19 species)
  7. 1915928Species South China Sea lobster (Palinurus versicolor) [TaxId:150436] [55359] (5 PDB entries)
  8. 1915932Domain d1crwr2: 1crw R:149-312 [39942]
    Other proteins in same PDB: d1crwg1, d1crwr1

Details for d1crwr2

PDB Entry: 1crw (more details), 2 Å

PDB Description: crystal structure of apo-glyceraldehyde-3-phosphate dehydrogenase from palinurus versicolor at 2.0a resolution
PDB Compounds: (R:) d-glyceraldehyde-3-phosphate-dehydrogenase

SCOPe Domain Sequences for d1crwr2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1crwr2 d.81.1.1 (R:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {South China Sea lobster (Palinurus versicolor) [TaxId: 150436]}
cttnclapvakvlhenfeiveglmttvhavtatqktvdgpsakdwrggrgaaqniipsst
gaakavgkvipeldgkltgmafrvptpnvsvvdltvrlgkecsyddikaamkaasegplq
gvlgyteddvvscdftgdnrssifdakagiqlsktfvkvvswyd

SCOPe Domain Coordinates for d1crwr2:

Click to download the PDB-style file with coordinates for d1crwr2.
(The format of our PDB-style files is described here.)

Timeline for d1crwr2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1crwr1