SCOPe 2.08: Domain d7kmhb1: 7kmh B:1-106

Lineage for d7kmhb1 (7kmh B:1-106)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d7kmhb1: 7kmh B:1-106 [399417]
   Other proteins in same PDB: d7kmha1, d7kmha2, d7kmhb2, d7kmhc1, d7kmhc2
   automated match to d1dn0a1
   complexed with gol, nag, pro

Details for d7kmhb1

PDB Entry: 7kmh, 1.72 Å

PDB Description: ly-cov488 neutralizing antibody against sars-cov-2

PDB Compounds: (B:) LY-CoV488 Fab light chain

SCOPe Domain Sequences for d7kmhb1:

Sequence; same for both SEQRES and ATOM records:

>d7kmhb1 b.1.1.0 (B:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspsslsasvgdrvtitcqasqdisnylnwyqqkpgkapklliydasnletgvps
rfsgsgsgtdftftisslqpediatyycqqydnlpitfgqgtrlei

Timeline for d7kmhb1:

• d7kmhb1 first appeared in SCOPe 2.07