SCOPe 2.01: Domain d1crwg2: 1crw G:149-312

Lineage for d1crwg2 (1crw G:149-312)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
   core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1

4. Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families)
   N-terminal domain is the classic Rossmann-fold

5. Family d.81.1.1: GAPDH-like [55348] (6 proteins)
   has many additional secondary structures

6. Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (19 species)

7. Species South China Sea lobster (Palinurus versicolor) [TaxId:150436] [55359] (5 PDB entries)

8. Domain d1crwg2: 1crw G:149-312 [39941]
   Other proteins in same PDB: d1crwg1, d1crwr1

Details for d1crwg2

PDB Entry: 1crw, 2 Å

PDB Description: crystal structure of apo-glyceraldehyde-3-phosphate dehydrogenase from palinurus versicolor at 2.0a resolution

PDB Compounds: (G:) d-glyceraldehyde-3-phosphate-dehydrogenase

SCOPe Domain Sequences for d1crwg2:

Sequence; same for both SEQRES and ATOM records:

>d1crwg2 d.81.1.1 (G:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {South China Sea lobster (Palinurus versicolor) [TaxId: 150436]}
cttnclapvakvlhenfeiveglmttvhavtatqktvdgpsakdwrggrgaaqniipsst
gaakavgkvipeldgkltgmafrvptpnvsvvdltvrlgkecsyddikaamkaasegplq
gvlgyteddvvscdftgdnrssifdakagiqlsktfvkvvswyd

Timeline for d1crwg2:

• d1crwg2 first appeared (with stable ids) in SCOP 1.55
  
• d1crwg2 appears in SCOP 1.75
  
• d1crwg2 appears in SCOPe 2.02
  
• d1crwg2 appears in the current release, SCOPe 2.08