Lineage for d1szjr2 (1szj R:149-312)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 866361Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 866362Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 866363Family d.81.1.1: GAPDH-like [55348] (6 proteins)
    has many additional secondary structures
  6. 866417Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (19 species)
  7. 866561Species South China Sea lobster (Palinurus versicolor) [TaxId:150436] [55359] (5 PDB entries)
  8. 866565Domain d1szjr2: 1szj R:149-312 [39940]
    Other proteins in same PDB: d1szjg1, d1szjr1
    complexed with nad, so4

Details for d1szjr2

PDB Entry: 1szj (more details), 2 Å

PDB Description: structure of holo-glyceraldehyde-3-phosphate-dehydrogenase from palinurus versicolor refined 2.0 angstrom resolution
PDB Compounds: (R:) d-glyceraldehyde-3-phosphate-dehydrogenase

SCOP Domain Sequences for d1szjr2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1szjr2 d.81.1.1 (R:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {South China Sea lobster (Palinurus versicolor) [TaxId: 150436]}
cttnclapvakvlhenfeiveglmttvhavtatqktvdgpsakdwrggrgaaqniipsst
gaakavgkvipeldgkltgmafrvptpnvsvvdltvrlgkecsyddikaamkaasegplq
gvlgyteddvvscdftgdnrssifdakagiqlsktfvkvvswyd

SCOP Domain Coordinates for d1szjr2:

Click to download the PDB-style file with coordinates for d1szjr2.
(The format of our PDB-style files is described here.)

Timeline for d1szjr2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1szjr1