Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
Domain d7kzbb1: 7kzb B:2-106 [399389] Other proteins in same PDB: d7kzbb2, d7kzbc_, d7kzbh_, d7kzbl2 automated match to d1dn0a1 complexed with cl |
PDB Entry: 7kzb (more details), 2.83 Å
SCOPe Domain Sequences for d7kzbb1:
Sequence, based on SEQRES records: (download)
>d7kzbb1 b.1.1.0 (B:2-106) automated matches {Human (Homo sapiens) [TaxId: 9606]} iqmtqspsslsasvgdrvtitcrasqsiysalnwyqqkpgkapklliyaasalqsgvpsr fsgsgsgtdftltisslqpedfatyycqqtdihpytfgqgtkvei
>d7kzbb1 b.1.1.0 (B:2-106) automated matches {Human (Homo sapiens) [TaxId: 9606]} iqmtqspsslsasvgdrvtitcrasqsiysalnwyqklliyaasalqsgvpsrfsgsgsg tdftltisslqpedfatyycqqtdihpytfgqgtkvei
Timeline for d7kzbb1:
View in 3D Domains from other chains: (mouse over for more information) d7kzbc_, d7kzbh_, d7kzbl1, d7kzbl2 |