Lineage for d7kzbb1 (7kzb B:2-106)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2758667Domain d7kzbb1: 7kzb B:2-106 [399389]
    Other proteins in same PDB: d7kzbb2, d7kzbc_, d7kzbh_, d7kzbl2
    automated match to d1dn0a1
    complexed with cl

Details for d7kzbb1

PDB Entry: 7kzb (more details), 2.83 Å

PDB Description: potent sars-cov-2 binding and neutralization through maturation of iconic sars-cov-1antibodies
PDB Compounds: (B:) Fab light chain of CR3022-B6 antibody

SCOPe Domain Sequences for d7kzbb1:

Sequence, based on SEQRES records: (download)

>d7kzbb1 b.1.1.0 (B:2-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqmtqspsslsasvgdrvtitcrasqsiysalnwyqqkpgkapklliyaasalqsgvpsr
fsgsgsgtdftltisslqpedfatyycqqtdihpytfgqgtkvei

Sequence, based on observed residues (ATOM records): (download)

>d7kzbb1 b.1.1.0 (B:2-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqmtqspsslsasvgdrvtitcrasqsiysalnwyqklliyaasalqsgvpsrfsgsgsg
tdftltisslqpedfatyycqqtdihpytfgqgtkvei

SCOPe Domain Coordinates for d7kzbb1:

Click to download the PDB-style file with coordinates for d7kzbb1.
(The format of our PDB-style files is described here.)

Timeline for d7kzbb1: