Lineage for d1dssr2 (1dss R:149-312)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 727888Fold d.81: FwdE/GAPDH domain-like [55346] (3 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 727889Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 727890Family d.81.1.1: GAPDH-like [55348] (6 proteins)
    has many additional secondary structures
  6. 727944Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (19 species)
  7. 728075Species South China Sea lobster (Palinurus versicolor) [TaxId:82835] [55359] (5 PDB entries)
  8. 728079Domain d1dssr2: 1dss R:149-312 [39938]
    Other proteins in same PDB: d1dssg1, d1dssr1
    complexed with nad, so4

Details for d1dssr2

PDB Entry: 1dss (more details), 1.88 Å

PDB Description: structure of active-site carboxymethylated d-glyceraldehyde-3-phosphate dehydrogenase from palinurus versicolor
PDB Compounds: (R:) d-glyceraldehyde-3-phosphate-dehydrogenase

SCOP Domain Sequences for d1dssr2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dssr2 d.81.1.1 (R:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {South China Sea lobster (Palinurus versicolor) [TaxId: 82835]}
cttnclapvakvlhenfeiveglmttvhavtatqktvdgpsakdwrggrgaaqniipsst
gaakavgkvipeldgkltgmafrvptpnvsvvdltvrlgkecsyddikaamkaasegplq
gvlgyteddvvscdftgdnrssifdakagiqlsktfvkvvswyd

SCOP Domain Coordinates for d1dssr2:

Click to download the PDB-style file with coordinates for d1dssr2.
(The format of our PDB-style files is described here.)

Timeline for d1dssr2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dssr1