Lineage for d7kscb_ (7ksc B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2328002Fold a.52: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47698] (1 superfamily)
    4 helices; folded leaf; right-handed superhelix
  4. 2328003Superfamily a.52.1: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47699] (4 families) (S)
    can be classified as disulfide-rich
  5. 2328004Family a.52.1.1: Plant lipid-transfer and hydrophobic proteins [47700] (4 proteins)
  6. 2328049Protein automated matches [190480] (4 species)
    not a true protein
  7. 2328058Species Punica granatum [TaxId:22663] [399357] (1 PDB entry)
  8. 2328060Domain d7kscb_: 7ksc B: [399369]
    automated match to d1fk5a_
    complexed with so4

Details for d7kscb_

PDB Entry: 7ksc (more details), 2.4 Å

PDB Description: crystal structure of pun g 1.0101
PDB Compounds: (B:) Non-specific lipid-transfer protein

SCOPe Domain Sequences for d7kscb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7kscb_ a.52.1.1 (B:) automated matches {Punica granatum [TaxId: 22663]}
avtcgqvasslapcipyarsaggavppaccsgiktldgmarttpdrqatckclksastsi
sginyglvaslpakcgvnipykispstdcarvk

SCOPe Domain Coordinates for d7kscb_:

Click to download the PDB-style file with coordinates for d7kscb_.
(The format of our PDB-style files is described here.)

Timeline for d7kscb_: