SCOPe 2.08: Domain d7kpbl1: 7kpb L:1-107

Lineage for d7kpbl1 (7kpb L:1-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d7kpbl1: 7kpb L:1-107 [399364]
   Other proteins in same PDB: d7kpba_, d7kpbb_, d7kpbc_, d7kpbh_, d7kpbl2
   automated match to d1a5fl1
   complexed with d84, gol, nag

Details for d7kpbl1

PDB Entry: 7kpb, 3 Å

PDB Description: mtnf-alpha htnfr1 complex

PDB Compounds: (L:) Fab1974 - Light Chain

SCOPe Domain Sequences for d7kpbl1:

Sequence; same for both SEQRES and ATOM records:

>d7kpbl1 b.1.1.0 (L:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
diqmtqspaslpaspeeivtitcqasqdignwlswyqqkpgkspqlliygatsladgvps
rfsasrsgtqyslkisrlqvedfgifyclqgqstpytfgagtklelk

Timeline for d7kpbl1:

• d7kpbl1 first appeared in SCOPe 2.07