Class a: All alpha proteins [46456] (289 folds) |
Fold a.52: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47698] (1 superfamily) 4 helices; folded leaf; right-handed superhelix |
Superfamily a.52.1: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47699] (4 families) can be classified as disulfide-rich |
Family a.52.1.1: Plant lipid-transfer and hydrophobic proteins [47700] (4 proteins) |
Protein automated matches [190480] (4 species) not a true protein |
Species Punica granatum [TaxId:22663] [399357] (1 PDB entry) |
Domain d7kscd_: 7ksc D: [399363] automated match to d1fk5a_ complexed with so4 |
PDB Entry: 7ksc (more details), 2.4 Å
SCOPe Domain Sequences for d7kscd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7kscd_ a.52.1.1 (D:) automated matches {Punica granatum [TaxId: 22663]} avtcgqvasslapcipyarsaggavppaccsgiktldgmarttpdrqatckclksastsi sginyglvaslpakcgvnipykispstdcarvk
Timeline for d7kscd_: