SCOPe 2.07: Domain d7ksbb_: 7ksb B:

Lineage for d7ksbb_ (7ksb B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.52: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47698] (1 superfamily)
   4 helices; folded leaf; right-handed superhelix

4. Superfamily a.52.1: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47699] (4 families)
   can be classified as disulfide-rich

5. Family a.52.1.0: automated matches [254196] (1 protein)
   not a true family

6. Protein automated matches [254428] (8 species)
   not a true protein

7. Species Actinidia chinensis [TaxId:1590841] [399346] (1 PDB entry)

8. Domain d7ksbb_: 7ksb B: [399352]
   automated match to d5tviw_
   complexed with so4

Details for d7ksbb_

PDB Entry: 7ksb, 1.95 Å

PDB Description: crystal structure on act c 10.0101

PDB Compounds: (B:) Non-specific lipid-transfer protein 1

SCOPe Domain Sequences for d7ksbb_:

Sequence; same for both SEQRES and ATOM records:

>d7ksbb_ a.52.1.0 (B:) automated matches {Actinidia chinensis [TaxId: 1590841]}
avscgqvdtsltpcltyltkggtpstqccsgvrslksmtgtkadrqaacnclkqaaaryq
gikdaaaaalsqkcgvqlsvpisrktdcskis

Timeline for d7ksbb_:

• d7ksbb_ is new in SCOPe 2.07-stable
  
• d7ksbb_ appears in the current release, SCOPe 2.08