![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.52: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47698] (1 superfamily) 4 helices; folded leaf; right-handed superhelix |
![]() | Superfamily a.52.1: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47699] (4 families) ![]() can be classified as disulfide-rich |
![]() | Family a.52.1.0: automated matches [254196] (1 protein) not a true family |
![]() | Protein automated matches [254428] (8 species) not a true protein |
![]() | Species Actinidia chinensis [TaxId:1590841] [399346] (1 PDB entry) |
![]() | Domain d7ksbb_: 7ksb B: [399352] automated match to d5tviw_ complexed with so4 |
PDB Entry: 7ksb (more details), 1.95 Å
SCOPe Domain Sequences for d7ksbb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7ksbb_ a.52.1.0 (B:) automated matches {Actinidia chinensis [TaxId: 1590841]} avscgqvdtsltpcltyltkggtpstqccsgvrslksmtgtkadrqaacnclkqaaaryq gikdaaaaalsqkcgvqlsvpisrktdcskis
Timeline for d7ksbb_: