Lineage for d1gpdg2 (1gpd G:149-312)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2568239Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 2568240Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 2568241Family d.81.1.1: GAPDH-like [55348] (6 proteins)
    has many additional secondary structures
  6. 2568332Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (21 species)
  7. 2568336Species American lobster (Homarus americanus) [TaxId:6706] [55358] (2 PDB entries)
  8. 2568337Domain d1gpdg2: 1gpd G:149-312 [39935]
    Other proteins in same PDB: d1gpdg1, d1gpdr1
    complexed with nad, po4

Details for d1gpdg2

PDB Entry: 1gpd (more details), 2.9 Å

PDB Description: studies of asymmetry in the three-dimensional structure of lobster d-glyceraldehyde-3-phosphate dehydrogenase
PDB Compounds: (G:) d-glyceraldehyde-3-phosphate dehydrogenase

SCOPe Domain Sequences for d1gpdg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gpdg2 d.81.1.1 (G:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {American lobster (Homarus americanus) [TaxId: 6706]}
cttnclapvakvlhenfeiveglmttvhavtatqktvdgpsakdwrggrgaaqniipsst
gaakavgkvipeldgkltgmafrvptpdvsvvdltvrlgkecsyddikaamktasegplq
gflgyteddvvssdfigdnrssifdakagiqlsktfvkvvswyd

SCOPe Domain Coordinates for d1gpdg2:

Click to download the PDB-style file with coordinates for d1gpdg2.
(The format of our PDB-style files is described here.)

Timeline for d1gpdg2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gpdg1