Lineage for d1gpdg2 (1gpd G:149-312)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 33775Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
  4. 33776Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
  5. 33777Family d.81.1.1: GAPDH-like [55348] (2 proteins)
  6. 33783Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (11 species)
  7. 33838Species Lobster (Homarus americanus) [55358] (2 PDB entries)
  8. 33843Domain d1gpdg2: 1gpd G:149-312 [39935]
    Other proteins in same PDB: d1gpdg1, d1gpdr1

Details for d1gpdg2

PDB Entry: 1gpd (more details), 2.9 Å

PDB Description: studies of asymmetry in the three-dimensional structure of lobster d-glyceraldehyde-3-phosphate dehydrogenase

SCOP Domain Sequences for d1gpdg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gpdg2 d.81.1.1 (G:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Lobster (Homarus americanus)}
cttnclapvakvlhenfeiveglmttvhavtatqktvdgpsakdwrggrgaaqniipsst
gaakavgkvipeldgkltgmafrvptpdvsvvdltvrlgkecsyddikaamktasegplq
gflgyteddvvssdfigdnrssifdakagiqlsktfvkvvswyd

SCOP Domain Coordinates for d1gpdg2:

Click to download the PDB-style file with coordinates for d1gpdg2.
(The format of our PDB-style files is described here.)

Timeline for d1gpdg2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gpdg1